PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA13674
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 352aa    MW: 40175.1 Da    PI: 7.1026
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA13674genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.93e-25206260155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                k r+rWt+eLHe+F+  v++LGG+ekA Pk+il++mk ++L+l+hvkSHLQk R+
  Tp57577_TGAC_v2_mRNA13674 206 KRRIRWTEELHESFMMIVDHLGGPEKAKPKAILDMMKSNSLSLSHVKSHLQKCRS 260
                                68**************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-22203261IPR009057Homeodomain-like
PROSITE profilePS512949.537203263IPR017930Myb domain
SuperFamilySSF466893.23E-13204260IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-20206260IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MYQHWSRMYG TQWESYMGIN NLVKVVGSEQ VMSFEPIKSS CNNIVTSSSN LETPYEGFGA  60
VTVAKIKSPV GFQGGEYYDE DQIEVPDWCF DQFPKITDPP LLNCQGSGDN FTSSLHSVSK  120
ESLLSNSADS QNSSEDEYSN FQSGNMSFYD HFPQNHDELM KNDASIDEKP FEISFQRIKS  180
GSPTKSPQLY GIGCATSSNN ASRKSKRRIR WTEELHESFM MIVDHLGGPE KAKPKAILDM  240
MKSNSLSLSH VKSHLQKCRS SERVHKALRE RSGEGHRTDK VTELQLKISY MQIEESRQLQ  300
LEVRKSISQQ LEMQRSLETL IEEHSKKLKV MQKEKTNERK SWTQREMTVP K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625243.20.0myb-like DNA-binding domain, shaqkyf class protein
TrEMBLG7KVB90.0G7KVB9_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA19G32841.11e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144901016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-24G2-like family protein